PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA61G00587
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 146aa    MW: 16828.1 Da    PI: 5.3639
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA61G00587genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.65.6e-132583563
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                ++ +r+++NR +ArrsRqRK++++  L ++v +L++ N++  ++++  +  + +++s++
  AA61G00587 25 RKRKRMISNRDSARRSRQRKQKQLGDLINEVTALKNDNSKITEQIDVSTRRYIEMESQN 83
                6789******************************************9999999888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-162185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3812386IPR004827Basic-leucine zipper domain
PfamPF001701.2E-112583IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.13E-112580No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-102570No hitNo description
CDDcd147022.95E-142676No hitNo description
PROSITE patternPS0003602843IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MASLQRQTSP ESDNDPKYVT VTDERKRKRM ISNRDSARRS RQRKQKQLGD LINEVTALKN  60
DNSKITEQID VSTRRYIEME SQNNVLRAQA LELTDRLRSL NSVLEMVEEI SGMALDIPEI  120
PESMQNPWQI PCSKQPIMAA ADMFDC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12445RKRKRMISNRDSARRSRQRKQK
23743RRSRQRK
33744RRSRQRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402377.15e-91hypothetical protein EUTSA_v10006418mg
SwissprotQ9LZP81e-89BZP53_ARATH; bZIP transcription factor 53
TrEMBLV4L0P06e-91V4L0P0_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.5__2740__AT3G62420.12e-89(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30362763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.11e-78basic region/leucine zipper motif 53